INTEL

AI-powered sector intelligence platform integrating real-time flow, structural analytics, and AI analysis across 10 thematic sectors

Sector Intel — AI-Driven Analysis

AI-Driven Sector Intelligence Platform

The Intel terminal monitors 10 thematic sectors × 70 stocks in real time. SECTOR COMMAND provides a consolidated overview of all sectors, while individual sector tabs deliver deep per-ticker analytics. Post-market, AI generates Cross-Sector Intelligence and independent sector reports automatically. Real-time pricing refreshes every 30 seconds.

Intel Page Full View

SECTOR COMMAND

10-Sector Command Center

SECTOR COMMAND consolidates core metrics across 10 sectors into a single dashboard. Top Leaders/Laggards instantly identify the strongest and weakest stocks among 70 tickers, while sector cards provide at-a-glance comparison of average change, GEX, Dark Pool, and Context Score.

Macro Quick Strip

The top strip displays the strongest sector (TOP), weakest sector (BOT), and the sector with the highest institutional activity (WHALE) in real time.

TOP BOT WHALE

Top Leaders / Laggards

From all 70 stocks, the top 3 by Context Score (Leaders) and bottom 3 (Laggards) are displayed as premium glassmorphism cards. Each card shows the live logo, ticker, price change, sector affiliation, and Context Score gauge.

CONTEXT LEADERS

Top 3 by Context Score — stocks with the strongest multi-source data alignment

CONTEXT LAGGARDS

Bottom 3 by Context Score — stocks showing the weakest structural data alignment

Live ticker logo with initial fallback display
Circular Context Score gauge with A–F grade color coding
Card click navigates to the stock's sector detail page

10 Sector Cards Grid

10 sector cards display a compressed snapshot of each sector's real-time flow dynamics.

Sector average price change — advancing/declining stock count
LEAD / LAG — sector's strongest and weakest constituents
GEX · Dark Pool · Context Score — core structural metrics per sector
Card click navigates to that sector's detail tab

SECTOR HEATMAP

Visualizes real-time price changes for 10 sectors × 70 stocks as a Finviz-style ECharts TreeMap. Tile size reflects price level and change magnitude; color represents price change direction. Sector header bars display average change, and tile clicks navigate to the respective sector tab.

Sector Heatmap — 10 Sectors × 70 Stocks TreeMap
Color legend: Deep green (+3% and above) ~ Light green (+0.5%) ~ Gray (0%) ~ Light red (-0.5%) ~ Deep red (-3% and below)
When the heatmap's color distribution skews heavily in one direction, it captures overall market sentiment; when color contrast between sectors is pronounced, it reveals rotation patterns.

SECTOR MOMENTUM RANKING

A premium ranking table sorting 10 sectors by average price change. Compare AVG Δ, GEX, PCR, Dark Pool, Context Score, and sector leader in a single row to instantly assess inter-sector relative strength.

SESSION GRID AI Analysis Engine

8-Category Conclusion Rule Engine

Session Grid goes beyond simple price display — a proprietary AI rule engine automatically generates structural market diagnostics for each ticker. The 4-block pipeline (Priority Signal → Structural Context → Flow Context → Conclusion) analyzes each stock's current positioning at institutional research note quality.

4-Block Analysis Pipeline

1PRIORITY SIGNAL

Detects the most urgent structural events first: imminent gamma squeeze, Call Wall/Put Floor proximity, stealth hedging activity.

2STRUCTURAL CONTEXT

Interprets current price's structural backdrop through Max Pain deviation, position within the Call Wall–Put Floor tunnel, and support/resistance zone analysis.

3FLOW CONTEXT

Synthesizes Gamma Regime × PCR cross-analysis, Net Premium direction, Whale Index, and Dark Pool ratio to diagnose the structural direction of capital flow.

4CONCLUSION

The 8-category (C1–C8) rule engine derives comprehensive verdicts from the 3 blocks above. Includes structural assessment, rationale summary, and transition conditions.

8-Category Conclusion Engine

The Conclusion Engine selects one of 8 structural conclusion codes by evaluating combinations of 11 derivative variables:

C1C1 — Upside Reaction Favorable: Short gamma + low PCR + squeeze conditions, gamma acceleration zone
C2C2 — Downside Pressure Dominant: Short gamma + high PCR + Put Floor proximity, structurally bearish environment
C3C3 — Expiration Convergence: Max Pain proximity + long gamma, range-bound convergence into expiration
C4C4 — Volatility Compression: Energy accumulation + tunnel narrowing, directional breakout imminent
C5C5 — Signal Conflict: Gamma neutral or cross-signal interference, observation required
C6C6 — Support Absorption: Put Floor proximity + institutional accumulation signals, monitoring for reversal potential
C7C7 — Resistance Friction: Call Wall proximity + insufficient upside energy, upward friction zone
C8C8 — Regime Transition Watch: Recent gamma regime flip (LONG↔SHORT), structural reset zone

DynamoDB History Context

The Conclusion Engine queries historical gamma regime records from DynamoDB. When a recent regime transition (LONG→SHORT or SHORT→LONG) is detected, the C8 code is automatically prioritized.

Analysis text at the bottom of each ticker card auto-highlights price levels ($xxx), percentages (%), and regime names (SHORT/LONG Gamma) for instant identification of key metrics.

Perplexity AI Real-Time Analysis

Real-Time AI Natural Language Analysis

Beyond rule-based analysis, Session Grid leverages Perplexity AI to generate intelligent natural language insights per ticker in real time. 11 derivative indicators (price, GEX, PCR, Gamma Regime, Net Premium, Call Wall, Put Floor, Max Pain, Whale Index, Dark Pool, IV Skew) are fed to the AI, producing positioning analysis simultaneously in Korean, English, and Japanese.

Per-ticker analysis — independent AI insights are generated for each of the 7 stocks in every sector
Trilingual simultaneous generation — Korean, English, and Japanese analysis produced in a single API call, instantly displayed matching the user's locale
Auto-trigger — switching sector tabs automatically transmits that sector's 7-ticker data to initiate AI analysis
AI analysis results are integrated alongside the rule engine analysis within each ticker card, providing simultaneous access to quantitative structural analysis and AI natural language interpretation.

Context Score Framework

5-Pillar Absolute Scoring

Context Score is an absolute scoring system. 80 points consistently means strong multi-source data alignment regardless of page or context. One engine, one scale — operating with a unified standard across the entire platform.

ANALYTICS SCOREGRADE A
Score
78
WATCH
Pillar Breakdown
MOMENTUM
21/25
STRUCTURE
18/25
FLOW
20/25
REGIME
12/15
CATALYST
7/10

5-Pillar Architecture (100-Point Scale)

MOMENTUM25pt

Price change · VWAP deviation · MACD crossover · SMA20 trend · 3-day cumulative return

STRUCTURE25pt

Put/Call Ratio · GEX gamma · Gamma Flip deviation · Squeeze probability · IV Skew · Options chain concentration

FLOW25pt

Dark pool ratio · Short volume ratio · Institutional concentration · Block trade frequency · Net premium direction

REGIME15pt

VIX level · Fear & Greed · Dollar index (DXY) · Yield curve shape · Sector rotation direction

CATALYST10pt

Earnings D-Day · FOMC schedule · Implied Move magnitude · AI sentiment analysis

Grade Scale

SGrade S — 85+ points – Extreme bullish data alignment
AGrade A — 70–84 points – Strong multi-source alignment
BGrade B — 55–69 points – Positive structure
CGrade C — 40–54 points – Neutral, direction undetermined
DGrade D — 25–39 points – Bearish structure
FGrade F — Below 24 points – Risk flag

Sentiment Map

STRONG BULLISHSTRONG BULLISH — Multi-source bullish data convergence
BULLISHBULLISH — Upside-biased structure
WATCHWATCH — Observation mode, additional data required
HOLDBALANCED — Neutral structure, direction pending
REDUCENEGATIVE BIAS — Bearish tilt, downside risk elevated
EXITRISK FLAG — Structural warning signals detected

Safety Gate System

The Analytics Engine is not simple score aggregation. Automatic downgrade triggers activate when hazardous patterns are detected — Call Wall breakout failures, excessive short interest, GEX regime shifts force score adjustments.

Sector Analysis Zones

5-Zone Sector Intelligence

Selecting a sector tab reveals 5 analysis zones arranged vertically. From real-time session data to AI reports, every intelligence dimension is accessible in a single view.

M7 Report Tab View

Zone A: Session Grid (Live Status Board)

Auto-detects U.S. market session (PRE-MKT · LIVE · POST-MKT · CLOSED). Each ticker displays real-time price, change rate, sparkline, options position bar, flow indicators, and one-line AI analysis.

PRE-MKT
LIVE
POST-MKT
CLOSED

Zone A-2: Ranking Row (3 Key Insights)

Three core structural rankings for the sector, presented as premium cards:

Money Flow — capital inflow/outflow intensity ranking: quantitative comparison of flow direction and magnitude
Squeeze Proximity — volatility threshold distance ranking: deviation from Call Wall/Put Floor
Pain Divergence — Max Pain divergence ranking: structural deviation between current price and convergence level

Zone B: Analyst Consensus + Earnings Calendar

Investment bank analyst opinion distribution (Strong Buy to Strong Sell) and upcoming earnings schedule displayed side by side for simultaneous fundamental event and research consensus verification.

Analyst Consensus Earnings Calendar

Zone C: Tactical Report Deck

Post-market AI-generated sector structural analysis reports. Stocks are classified into WATCH · HOLD · REDUCE groups with Context Score gauge, gamma signals, and AI commentary for each ticker.

WATCHHOLDREDUCE

POST-MARKET BRIEF

AI-Powered Daily Analysis

Every market close, AI Cross-Sector Intelligence cross-analyzes flow, structure, and momentum data across all 10 sectors to produce a comprehensive analysis report. Individual sector reports are accessible via accordion UI for selective deep-dives.

Cross-Sector Intelligence

Gemini AI cross-analyzes all 10 sectors' daily snapshots and macro data to produce integrated insights. Systematically covers market summary, inter-sector capital flow patterns, key signals, and risk factors.

Auto-generated daily at 4:50 PM ET after U.S. market close
Market summary, inter-sector capital rotation, key signals, risk analysis
10 sectors + macro data integrated cross-analysis

10 Sector Reports

Each sector receives an independent POST-MARKET REPORT. Accordion UI enables efficient selective consumption of sectors of interest.

Accordion UI — per-sector expand/collapse with batch expand/collapse support
MVP / WORST — automatic classification of sector best/worst performers
Sector Context Score — sector-wide weighted average Context Score gauge
Gamma Regime — PCR and GEX-based sector volatility environment diagnosis

10 Sector Intel

Thematic Sector Coverage — 70 Stocks

Each sector comprises 7 core stocks representing the theme, covering 70 stocks in total. Independent sector analysis reports are auto-generated, enabling relative strength comparison across sectors and within sector constituents.

M7

Magnificent 7 — Global big-tech leaders by market capitalization

AAPLAAPLNVDANVDAMSFTMSFTGOOGLGOOGLAMZNAMZNMETAMETATSLATSLA
PHYSICAL AI

Physical AI — Robotics · Autonomous systems · Space data in the physical AI domain

PLTRPLTRSERVSERVPLPLTERTERSYMSYMRKLBRKLBISRGISRG
SILICON CORE

Silicon Core — GPU · Foundry · Semiconductor equipment — AI infrastructure supply chain

AMDAMDAVGOAVGOTSMTSMARMARMMUMUASMLASMLMRVLMRVL
POWER MATRIX

Power Matrix — Nuclear · Renewables — AI datacenter power infrastructure

CEGCEGVSTVSTGEVGEVPWRPWRCCJCCJSMRSMRETNETN
BIO PULSE

Bio Pulse — GLP-1 · Immuno-oncology · Gene therapy — Next-gen biotech

LLYLLYNVONVOVRTXVRTXREGNREGNVKTXVKTXAMGNAMGNGILDGILD
CYBER SHIELD

Cyber Shield — Zero trust · AI security · Cloud defense — Cybersecurity

CRWDCRWDPANWPANWFTNTFTNTZSZSSSOKTAOKTANETNET
ORBIT DEFENSE

Orbit Defense — Satellites · Defense · Space infrastructure — Aerospace defense

LMTLMTRTXRTXAXONAXONKTOSKTOSLDOSLDOSASTSASTSLUNRLUNR
QUANTUM EDGE

Quantum Edge — Quantum computing · Next-gen semiconductors — Quantum technology

IONQIONQRGTIRGTIQBTSQBTSQUBTQUBTARQQARQQD-WAVED-WAVEFORMFORM
FINTECH PULSE

Fintech Pulse — Digital payments · Crypto · Challenger banks — Fintech

SQSQAFRMAFRMUPSTUPSTSOFISOFIXYZXYZCOINCOINNUNU
CLOUD FORTRESS

Cloud Fortress — SaaS · DevOps · Cloud infrastructure — Enterprise cloud

NOWNOWTEAMTEAMDDOGDDOGMDBMDBSNOWSNOWNETNETCRWDCRWD

Key Indicators Reference

Key Indicators Reference

Definitions and structural interpretation guidelines for core derivative and flow indicators referenced throughout the Intel page.

GEX (Gamma Exposure)
−GEX+GEX+2.4BBEARISHBULLISH

Net gamma exposure of options dealers. In positive (+GEX) environments, dealer hedging dampens price movement for stabilization; in negative (-GEX) environments, it amplifies momentum for acceleration.

+GEX: Dealers hedge against price movement, forming a range-bound environment. -GEX: Dealers hedge with price movement, creating self-reinforcing trends. Sign changes (Gamma Flip) represent regime transitions.

Dark Pool %
DARK POOL %62.4%50% Threshold

Percentage of total volume through institutional off-exchange trading. Above 50% indicates institutional participants bypassing public markets for block execution; cross-analysis with price direction infers accumulation/distribution.

DP↑ + Price↓: Suggests institutional accumulation during decline. DP↑ + Price↑: Suggests institutional distribution during rally.

P/C Ratio (Put/Call Ratio)
PUT/CALL RATIO0.82<0.7BULLISH0.8~1.2NEUTRAL>1.3BEARISH

Put option volume divided by call option volume. Below 1.0 indicates call dominance (bullish), above indicates put dominance (bearish) — an options market sentiment indicator.

Extreme call dominance below 0.7 has historically preceded corrections; extreme put dominance above 1.3 has historically preceded rebounds. 0.8–1.2 is neutral, requiring cross-reference with other indicators.

Squeeze (Squeeze Probability)
SQUEEZE LEVELHIGHMEDLOW🔥 FIRESQUEEZE

When Bollinger Bands contract within Keltner Channels, volatility energy accumulates; on release (Fire), directional movement occurs. Classified as LOW/MED/HIGH.

HIGH + short gamma combination structurally elevates bi-directional sharp movement probability. At the Fire point, accumulated energy is released with directional price action.

Net Premium
NET PREMIUM FLOWPUT ◀▶ CALL+$24.3MCALL DOMINANT

Call option premium total minus put option premium total. Positive indicates call-side (bullish) capital dominance; negative indicates put-side (bearish) capital dominance.

Positive + rising volume: Institutional bullish positioning concentrating. Negative + rising volume: Institutional bearish positioning concentrating.

Institutional Index
WHALE INDEXHIGH 🐋LOWMEDHIGH

Composite indicator estimating institutional accumulation/distribution by synthesizing GEX, dark pool ratio, and block trade frequency.

HIGH + Analytics Grade A: Active institutional accumulation indicated — bullish environment. LOW + price decline: Institutional interest has departed — supply-absent environment.

Data Analysis Workflow

Data Analysis Workflow

A systematic 4-step process for interpreting Intel page data.

01
Survey the landscape via SECTOR COMMAND

Review SECTOR COMMAND's Top Leaders/Laggards to instantly identify the strongest and weakest stocks and sectors among all 70 tickers. Use sectors with strong data alignment as starting points for deep analysis.

02
Observe sector rotation patterns

Compare average price changes and LEAD/LAG stocks across 10 sector cards to identify which themes capital is flowing toward. If the leading sector changes for 2–3 consecutive days, rotation is underway.

03
Prepare structural analysis via POST-MARKET BRIEF

Review AI Cross-Sector Intelligence after market close. Identify the day's inter-sector capital flows, key signals, and risk factors as preparation for next-day structural analysis.

04
Pre-check Earnings Calendar

Review earnings schedules via sector tab Earnings Calendar. IV surges are typical from D-3 onwards, and IV Crush is frequently observed immediately post-announcement — a structurally recurring pattern.

⚠️ Risk Disclosure & Disclaimer

All information provided by this service, including indicators, signals, and analytical outputs, represents quantitative analysis of market data and does not constitute investment advice, trade recommendations, or personalized financial guidance. Financial investments carry the risk of principal loss, and historical data and indicators do not guarantee future performance. All investment decisions are made under the user's sole responsibility, and the service provider bears no legal liability for outcomes thereof.

All information provided on this page — including indicators, signals, and analytical outputs — represents quantitative analysis of market data and does not constitute investment advice, trade recommendations, or personalized financial guidance. Past data and indicators do not guarantee future performance. All investment decisions are made at the user's sole discretion and responsibility.

SIGNUM HQ — Institutional-Grade Market Intelligence
SIGNUM HQ